PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400041061
Common NameLOC102587830
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 230aa    MW: 25797.3 Da    PI: 6.0647
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400041061genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF862.1e-27959151
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          k+ien s rqvtfskRr g++KKAeELSvLCdae+ vi+fs+t++lye++s
  PGSC0003DMP400041061  9 KKIENISSRQVTFSKRRSGLFKKAEELSVLCDAEIGVIVFSNTDRLYEFAS 59
                          68***********************************************86 PP

2K-box54.16.8e-19881581888
                 K-box  18 qqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelq 88 
                           + el+ Lk e+ +L++   +++G++L++L++keLqqLe+qL +++ ++++kK+++lle +e++  + +el 
  PGSC0003DMP400041061  88 EPELNSLKVEVAKLRKATGRMMGKELDDLDFKELQQLEHQLTEGILSVKNKKEQVLLELLEKSNLQIEELG 158
                           5699******************************************************9999887777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.469161IPR002100Transcription factor, MADS-box
CDDcd002652.81E-40277No hitNo description
SuperFamilySSF554559.42E-31276IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-27323IPR002100Transcription factor, MADS-box
PfamPF003199.2E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS512979.92284175IPR002487Transcription factor, K-box
PfamPF014861.1E-1287157IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009910Biological Processnegative regulation of flower development
GO:0048577Biological Processnegative regulation of short-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MGRGKIEMKK IENISSRQVT FSKRRSGLFK KAEELSVLCD AEIGVIVFSN TDRLYEFASS  60
KSSMEKIVDR YNNSSHSIEH PIVENIVEPE LNSLKVEVAK LRKATGRMMG KELDDLDFKE  120
LQQLEHQLTE GILSVKNKKE QVLLELLEKS NLQIEELGHK SCNHYPENYE AARKISGGNS  180
TVICDFKSVG EENSDTSLSL GLSVATSQKK RNPKIECTSN DSENLMILD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S2e-18188186Myocyte-specific enhancer factor 2B
1tqe_R2e-18188186Myocyte-specific enhancer factor 2B
1tqe_Q2e-18188186Myocyte-specific enhancer factor 2B
1tqe_P2e-18188186Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754492e-83HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006351403.11e-166PREDICTED: MADS-box transcription factor 23
TrEMBLM1C6V01e-166M1C6V0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000609951e-166(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13790.17e-41AGAMOUS-like 15
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]